SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P25106 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P25106
Domain Number 1 Region: 18-339
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.76e-63
Family Rhodopsin-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P25106
Sequence length 362
Comment (sp|P25106|ACKR3_HUMAN) G-protein coupled receptor RDC1 homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ACKR3; OC=Catarrhini; Hominidae; Homo.
Sequence
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMI
ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVT
HLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDT
YYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAIS
ASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT
QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQS
TK
Download sequence
Identical sequences P25106
ENSP00000272928 NP_064707.1.87134 NP_064707.1.92137 XP_005246154.1.92137 XP_005246155.1.92137 XP_016860005.1.92137 ENSP00000272928 ENSP00000405945 9606.ENSP00000272928 GO.104467 gi|31083344|ref|NP_064707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]