SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P25490 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P25490
Domain Number 1 Region: 333-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.35e-20
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 2 Region: 295-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000283
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Domain Number 3 Region: 377-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000637
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P25490
Sequence length 414
Comment (sp|P25490|TYY1_HUMAN) Yin and yang 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=YY1; OC=Catarrhini; Hominidae; Homo.
Sequence
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG
LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS
GKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
Download sequence
Identical sequences A0A2J8TL49 G3S7S5 P25490
NP_003394.1.87134 NP_003394.1.92137 XP_018865240.1.27298 ENSP00000262238 9606.ENSP00000262238 ENSP00000262238 ENSP00000262238 ENSGGOP00000024135 gi|4507955|ref|NP_003394.1| ENSGGOP00000024135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]