SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P25788 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P25788
Domain Number 1 Region: 13-239
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.16e-80
Family Proteasome subunits 0.00000000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P25788
Sequence length 255
Comment (sp|P25788|PSA3_HUMAN) Proteasome component C8 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PSMA3; OC=Catarrhini; Hominidae; Homo.
Sequence
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
Download sequence
Identical sequences A0A096NVD3 A0A0D9RPM3 A0A140VK43 A0A2I2YTJ4 A0A2K5JU81 A0A2K5N591 A0A2K5W6A0 A0A2K6A6M9 A0A2K6CHF9 A0A2K6QZT8 A0A2K6SPR0 F7E2S4 F7IS34 G1RRR8 H2NLC9 H2Q8D7 P25788
ENSPTRP00000010840 Hs4506183___KOG0184 ENSPPYP00000006652 ENSCJAP00000034840 ENSCJAP00000034840 ENSPPYP00000006652 5a0q_G 5a0q_U 5dsv_A 5dsv_B 5dsv_C 5dsv_D 5dsv_E 5dsv_F 5dsv_G 5dsv_H 5dsv_I 5dsv_J 5dsv_K 5dsv_L 5dsv_M 5dsv_N 5gjq_X 5gjq_n 5gjr_X 5gjr_n 5l4g_G 5l4g_T 5le5_F 5le5_T 5lex_F 5lex_T 5ley_F 5ley_T 5lez_F 5lez_T 5lf0_F 5lf0_T 5lf1_F 5lf1_T 5lf3_F 5lf3_T 5lf4_F 5lf4_T 5lf6_F 5lf6_T 5lf7_F 5lf7_T 5ln3_G 5m32_F 5m32_T 6avo_J 6avo_Q ENSNLEP00000015936 ENSP00000216455 9544.ENSMMUP00000004676 9598.ENSPTRP00000010840 9600.ENSPPYP00000006652 9606.ENSP00000216455 ENSP00000216455 ENSPTRP00000010840 ENSMMUP00000004676 NP_001247825.1.72884 NP_002779.1.87134 NP_002779.1.92137 XP_001164848.1.37143 XP_002754003.1.60252 XP_002824839.1.23681 XP_003267783.1.23891 XP_003930533.1.74449 XP_005561417.1.63531 XP_007985003.1.81039 XP_008955262.1.60992 XP_010355990.1.97406 XP_011725795.1.29376 XP_011817274.1.43180 XP_011844974.1.47321 XP_011917338.1.92194 XP_018865204.1.27298 ENSMMUP00000004676 ENSPANP00000017008 ENSNLEP00000015936 ENSP00000216455 gi|4506183|ref|NP_002779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]