SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P26439 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P26439
Domain Number 1 Region: 1-280,328-356
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.05e-54
Family Tyrosine-dependent oxidoreductases 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P26439
Sequence length 372
Comment (sp|P26439|3BHS2_HUMAN) Delta-5-3-ketosteroid isomerase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HSD3B2; OC=Catarrhini; Hominidae; Homo.
Sequence
MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEG
DILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI
YTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLY
TCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR
DPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVV
SFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV
DRHKETLKSKTQ
Download sequence
Identical sequences A0A024R0F9 P26439
ENSP00000358424 ENSP00000445122 9606.ENSP00000358424 gi|260763931|ref|NP_001159592.1| gi|4504509|ref|NP_000189.1| ENSP00000388292 NP_000189.1.87134 NP_000189.1.92137 NP_001159592.1.87134 NP_001159592.1.92137 ENSP00000358424 ENSP00000445122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]