SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P26678 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P26678
Sequence length 52
Comment (sp|P26678|PPLA_HUMAN) Cardiac phospholamban KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PLN; OC=Catarrhini; Hominidae; Homo.
Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Download sequence
Identical sequences P26678 Q5R352
ENSP00000350132 1zll_A 1zll_B 1zll_C 1zll_D 1zll_E 2hyn_A 2hyn_B 2hyn_C 2hyn_D 2hyn_E 9606.ENSP00000350132 ENSP00000350132 cath|current|1zllA00/1-52 cath|current|1zllB00/1-52 cath|current|1zllC00/1-52 cath|current|1zllD00/1-52 cath|current|1zllE00/1-52 cath|current|2hynA00/1-52 cath|current|2hynB00/1-52 cath|current|2hynC00/1-52 cath|current|2hynD00/1-52 cath|current|2hynE00/1-52 NP_002658.1.87134 NP_002658.1.92137 ENSP00000350132 gi|4505887|ref|NP_002658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]