SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P28161 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P28161
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.32e-46
Family Glutathione S-transferase (GST), C-terminal domain 0.000000163
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.48e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P28161
Sequence length 218
Comment (sp|P28161|GSTM2_HUMAN) GSTM2-2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GSTM2; OC=Catarrhini; Hominidae; Homo.
Sequence
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Download sequence
Identical sequences P28161
gi|4504175|ref|NP_000839.1| 9606.ENSP00000241337 ENSP00000241337 ENSP00000241337 NP_000839.1.87134 NP_000839.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]