SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P30203 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P30203
Domain Number 1 Region: 155-263
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 261-364
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 3 Region: 41-157
Classification Level Classification E-value
Superfamily SRCR-like 9.94e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P30203
Sequence length 668
Comment (sp|P30203|CD6_HUMAN) Soluble CD6 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CD6; OC=Catarrhini; Hominidae; Homo.
Sequence
MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEV
RLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANAT
LAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHG
EWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK
VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLC
SASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDS
GSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTA
NPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP
NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDND
DYDDISAA
Download sequence
Identical sequences P30203
NP_006716.3.87134 NP_006716.3.92137 ENSP00000323280 ENSP00000323280 gi|194018748|ref|NP_006716.3| ENSP00000345566 9606.ENSP00000323280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]