SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P30438 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P30438
Domain Number 1 Region: 23-92
Classification Level Classification E-value
Superfamily Uteroglobin-like 1.6e-20
Family Uteroglobin-like 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P30438
Sequence length 92
Comment (sp|P30438|FEL1A_FELCA) Allergen Fel d I-A KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=CH1; OC=Felinae; Felis.
Sequence
MKGACVLVLLWAALLLISGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENA
RILKNCVDAKMTEEDKENALSVLDKIYTSPLC
Download sequence
Identical sequences P30438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]