SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P30440 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P30440
Domain Number 1 Region: 22-90
Classification Level Classification E-value
Superfamily Uteroglobin-like 1.03e-23
Family Uteroglobin-like 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P30440
Sequence length 109
Comment (sp|P30440|FEL1B_FELCA) Allergen Fel d I-B KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=CH2 OC=Felinae; Felis.
Sequence
MRGALLVLALLVTQALGVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMK
KIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGR
Download sequence
Identical sequences P30440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]