SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P31152 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P31152
Domain Number 1 Region: 12-320
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-79
Family Protein kinases, catalytic subunit 0.000000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P31152
Sequence length 587
Comment (sp|P31152|MK04_HUMAN) MAP kinase isoform p63 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MAPK4; OC=Catarrhini; Hominidae; Homo.
Sequence
MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LAEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLRVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDIVLMAANQSQLSNWDTCSSRYPVS
LSSDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSHSSSERFLEQSHSSMERAF
EADYGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPTATGLADTG
AREDEPASLFLEIAQWVKSTQGGPEHASPPADDPERRLSASPPGRPAPVDGGASPQFDLD
VFISRALKLCTKPEDLPDNKLGDLNGACIPEHPGDLVQTEAFSKERW
Download sequence
Identical sequences P31152
ENSP00000383234 ENSP00000459039 NP_002738.2.87134 NP_002738.2.92137 XP_005258356.1.92137 XP_011524376.1.92137 XP_011524377.1.92137 XP_011524378.1.92137 XP_016881328.1.92137 9606.ENSP00000383234 gi|89276769|ref|NP_002738.2| ENSP00000383234 ENSP00000383234 ENSP00000459073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]