SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P31371 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P31371
Domain Number 1 Region: 54-201
Classification Level Classification E-value
Superfamily Cytokine 6.28e-55
Family Fibroblast growth factors (FGF) 0.0000000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P31371
Sequence length 208
Comment (sp|P31371|FGF9_HUMAN) Heparin-binding growth factor 9 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FGF9; OC=Catarrhini; Hominidae; Homo.
Sequence
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
Download sequence
Identical sequences A0A2I3LM65 A0A2K5LAH6 A0A2K5Y540 A0A2K6CAK7 A0A2K6EWQ5 A0A2K6M2F5 A0A2K6PV23 D2I195 F6YCT2 F7B6A2 G1P287 G1RSA3 G1SDY3 G3QQL4 G7PVU6 H2NJD6 H2Q7A1 I3NDZ3 J9P0B3 L9JF37 M3X6Y4 M3XNG7 P31371 S7NI60
ENSNLEP00000016125 ENSECAP00000016305 ENSP00000371790 ENSMLUP00000003970 ENSCAFP00000038985 ENSP00000371790 ENSPTRP00000009715 ENSPPYP00000005926 ENSMPUP00000000617 ENSMLUP00000003970 ENSSTOP00000022590 ENSMPUP00000000617 ENSPANP00000010333 gi|4503707|ref|NP_002001.1| ENSFCAP00000005566 ENSECAP00000016305 ENSGGOP00000004882 ENSTBEP00000001253 ENSTBEP00000001253 ENSP00000371790 ENSOCUP00000000634 ENSNLEP00000016125 ENSAMEP00000011507 9361.ENSDNOP00000003693 9598.ENSPTRP00000009715 9600.ENSPPYP00000005926 9606.ENSP00000371790 9615.ENSCAFP00000010638 9685.ENSFCAP00000005566 9796.ENSECAP00000016305 ENSDNOP00000003693 NP_002001.1.87134 NP_002001.1.92137 XP_001150741.1.37143 XP_002712845.1.1745 XP_002824119.1.23681 XP_002928971.1.58354 XP_003273151.1.23891 XP_003833080.1.60992 XP_003980306.1.62641 XP_004054293.1.27298 XP_004401396.1.74151 XP_004435313.1.5094 XP_004467605.1.11602 XP_004680318.1.23501 XP_004774396.1.14098 XP_005338663.1.77405 XP_005585527.1.63531 XP_005601151.1.31192 XP_005880049.1.60319 XP_006085580.1.53796 XP_006159582.1.99106 XP_006727907.1.47382 XP_006773229.1.95426 XP_007074423.1.5354 XP_008159310.1.99482 XP_008530350.1.77740 XP_008690358.1.72690 XP_010354218.1.97406 XP_011754020.1.29376 XP_011831929.1.47321 XP_011928753.1.92194 XP_012497148.1.63892 XP_012634144.1.48125 XP_014692623.1.49734 XP_014933254.1.86478 XP_014976217.1.72884 XP_016068395.1.3490 XP_017741791.1.44346 XP_019303534.1.44245 XP_019489761.1.44202 XP_020008034.1.5219 XP_021533902.1.83697 XP_849938.1.84170 ENSPTRP00000009715 ENSGGOP00000004882 ENSAMEP00000011512 ENSPPYP00000005926 ENSCAFP00000038985 ENSSTOP00000022590 ENSFCAP00000022386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]