SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P31785 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P31785
Domain Number 1 Region: 57-164
Classification Level Classification E-value
Superfamily Fibronectin type III 6.35e-29
Family Fibronectin type III 0.00000442
Further Details:      
 
Domain Number 2 Region: 152-246
Classification Level Classification E-value
Superfamily Fibronectin type III 8.93e-17
Family Fibronectin type III 0.000000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
axon 1.501 41.37
cell body 1.534 31.5
cytoplasmic region 1.567 18.37
presynapse 1.758 18.37
cell surface 1.3 17
neuron to neuron synapse 1.722 14.23
synaptic membrane 1.923 14.23
postsynaptic density of dendrite 1.786 14.23
extracellular space 1.3 13.93
collagen trimer 2.224 13.02

Protein sequence

External link(s) P31785
Sequence length 369
Comment (sp|P31785|IL2RG_HUMAN) p64 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IL2RG; OC=Catarrhini; Hominidae; Homo.
Sequence
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
PCYTLKPET
Download sequence
Identical sequences P31785
ENSP00000363303 ENSP00000363318 9606.ENSP00000276110 ENSP00000363318 gi|4557882|ref|NP_000197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]