SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P35227 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P35227
Domain Number 1 Region: 14-68
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000374
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P35227
Sequence length 344
Comment (sp|P35227|PCGF2_HUMAN) Zinc finger protein 144 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PCGF2; OC=Catarrhini; Hominidae; Homo.
Sequence
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKF
LRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLAT
VPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT
Download sequence
Identical sequences A0A024R1V6 P35227
ENSP00000354033 ENSP00000478517 ENSP00000478970 ENSP00000482063 ENSP00000482815 gi|6005964|ref|NP_009075.1| 9606.ENSP00000354033 NP_009075.1.87134 NP_009075.1.92137 XP_005257697.1.92137 XP_005257698.1.92137 XP_005257699.1.92137 XP_016880505.1.92137 10336 HT6300 ENSP00000354033 ENSP00000461961 ENSP00000463440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]