SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P35579 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P35579
Domain Number 1 Region: 55-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.73e-293
Family Motor proteins 1.77e-16
Further Details:      
 
Domain Number 2 Region: 836-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.97e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 956-1072
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.72e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1242-1349
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.02e-18
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1060-1151
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000209
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1514-1627
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000462
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1348-1450
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000262
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1759-1860
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000647
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  P35579
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0392
Family Myosin S1 fragment, N-terminal domain 0.0016
Further Details:      
 
Domain Number - Region: 1626-1743
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0706
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P35579
Sequence length 1960
Comment (sp|P35579|MYH9_HUMAN) Non-muscle myosin heavy chain IIa KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MYH9; OC=Catarrhini; Hominidae; Homo.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL
ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQ
YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences A0A024R1N1 A0A2I3SQU2 P35579
9606.ENSP00000216181 ENSP00000216181 ENSP00000216181 ENSP00000216181 NP_002464.1.87134 NP_002464.1.92137 XP_011528499.1.92137 XP_016794573.1.37143 XP_016884292.1.92137 XP_016884293.1.92137 XP_016884294.1.92137 XP_016884295.1.92137 gi|12667788|ref|NP_002464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]