SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P35637 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P35637
Domain Number 1 Region: 273-386
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-22
Family Canonical RBD 0.000081
Further Details:      
 
Domain Number 2 Region: 415-454
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000549
Family Ran binding protein zinc finger-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P35637
Sequence length 526
Comment (sp|P35637|FUS_HUMAN) Translocated in liposarcoma protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FUS; OC=Catarrhini; Hominidae; Homo.
Sequence
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Download sequence
Identical sequences P35637 Q6IBQ5
NP_004951.1.87134 NP_004951.1.92137 HR6430 gi|4826734|ref|NP_004951.1| ENSP00000254108 9606.ENSP00000254108 ENSP00000254108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]