SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P35908 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P35908
Domain Number 1 Region: 409-486
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.19e-22
Family Intermediate filament protein, coiled coil region 0.00051
Further Details:      
 
Domain Number 2 Region: 177-211
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000387
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 222-287
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000136
Family Intermediate filament protein, coiled coil region 0.0073
Further Details:      
 
Weak hits

Sequence:  P35908
Domain Number - Region: 299-411
Classification Level Classification E-value
Superfamily Prefoldin 0.0016
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P35908
Sequence length 639
Comment (sp|P35908|K22E_HUMAN) Type-II keratin Kb2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KRT2; OC=Catarrhini; Hominidae; Homo.
Sequence
MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGS
RSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGG
GRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQERE
QIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGTRPINLEPIFQGYIDSLKRYL
DGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQ
SKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIA
QRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNV
QDAIADAEQRGEHALKDARNKLNDLEEALQQAKEDLARLLRDYQELMNVKLALDVEIATY
RKLLEGEECRMSGDLSSNVTVSVTSSTISSNVASKAAFGGSGGRGSSSGGGYSSGSSSYG
SGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGG
GSRGGSSSGGGYGSGGGGSSSVKGSSGEAFGSSVTFSFR
Download sequence
Identical sequences P35908
ENSP00000310861 NP_000414.2.87134 NP_000414.2.92137 ENSP00000310861 ENSP00000310861 gi|47132620|ref|NP_000414.2| 9606.ENSP00000310861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]