SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P36542 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P36542
Domain Number 1 Region: 26-297
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 2.75e-84
Family ATP synthase (F1-ATPase), gamma subunit 0.000000000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
organelle envelope 1.405 12.08
inner mitochondrial membrane protein complex 1.946 6.55
plastid 1.525 5.41

Protein sequence

External link(s) P36542
Sequence length 298
Comment (sp|P36542|ATPG_HUMAN) F-ATPase gamma subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ATP5C1; OC=Catarrhini; Hominidae; Homo.
Sequence
MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVAT
LTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYY
SLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
Download sequence
Identical sequences G3R2N5 H2R2Y8 P36542
ENSGGOP00000009493 ENSP00000349142 ENSPTRP00000044643 9598.ENSPTRP00000056305 9606.ENSP00000349142 gi|50345988|ref|NP_001001973.1| ENSGGOP00000009493 ENSPTRP00000044643 ENSP00000338568 ENSP00000349142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]