SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P36544 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P36544
Domain Number 1 Region: 230-494
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 4.06e-78
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0000195
Further Details:      
 
Domain Number 2 Region: 26-229
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 9.02e-72
Family Nicotinic receptor ligand binding domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P36544
Sequence length 502
Comment (sp|P36544|ACHA7_HUMAN) Neuronal acetylcholine receptor subunit alpha-7 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CHRNA7; OC=Catarrhini; Hominidae; Homo.
Sequence
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Download sequence
Identical sequences A0A2J8J8V6 P36544
NP_000737.1.87134 NP_000737.1.92137 XP_001164138.1.37143 XP_003826096.1.60992 ENSP00000303727 gi|4502831|ref|NP_000737.1| ENSP00000303727 ENSP00000405989 9598.ENSPTRP00000011728 9606.ENSP00000303727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]