SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P40123 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P40123
Domain Number 1 Region: 45-241
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 1.18e-74
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.00001
Further Details:      
 
Domain Number 2 Region: 323-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 1.44e-64
Family C-terminal domain of adenylylcyclase associated protein 0.000000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P40123
Sequence length 477
Comment (sp|P40123|CAP2_HUMAN) Adenylyl cyclase-associated protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CAP2; OC=Catarrhini; Hominidae; Homo.
Sequence
MANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEF
LKNSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTF
RERNRGSNMFNHLSAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLR
HVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTVSAFSVLSSGPGLPPPPPPLPP
PGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQ
SPTKSHTPSPTSPKSYPSQKHAPVLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCE
KSTIQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCH
IYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPIPEQFKTAWDGSKLITEPAEIMA
Download sequence
Identical sequences P40123
NP_006357.1.87134 NP_006357.1.92137 gi|5453593|ref|NP_006357.1| 9606.ENSP00000229922 ENSP00000229922 ENSP00000229922 ENSP00000229922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]