SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P40189 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P40189
Domain Number 1 Region: 24-123
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-46
Family Fibronectin type III 0.00000104
Further Details:      
 
Domain Number 2 Region: 123-221
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-26
Family Fibronectin type III 0.00000116
Further Details:      
 
Domain Number 3 Region: 220-326
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-24
Family Fibronectin type III 0.000000613
Further Details:      
 
Domain Number 4 Region: 436-610
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-19
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 324-411
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000182
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P40189
Sequence length 918
Comment (sp|P40189|IL6RB_HUMAN) Oncostatin-M receptor subunit alpha KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IL6ST; OC=Catarrhini; Hominidae; Homo.
Sequence
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ
Download sequence
Identical sequences P40189
9606.ENSP00000338799 ENSP00000338799 ENSP00000370698 ENSP00000462158 gi|28610147|ref|NP_002175.2| NP_002175.2.87134 NP_002175.2.92137 ENSP00000338799 ENSP00000370698 ENSP00000462158 ENSP00000338799 NYSGRC-IgSF-IL6RB_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]