SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P40305 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P40305
Sequence length 119
Comment (sp|P40305|IFI27_HUMAN) Interferon-stimulated gene 12a protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IFI27; OC=Catarrhini; Hominidae; Homo.
Sequence
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIAS
SSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
Download sequence
Identical sequences P40305
ENSP00000298902 ENSP00000451956 9606.ENSP00000298902 NP_001275883.1.92137 NP_001275886.1.92137 NP_001275887.1.92137 NP_001275924.1.92137 NP_005523.3.92137 gi|55925614|ref|NP_005523.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]