SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P41159 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P41159
Domain Number 1 Region: 24-167
Classification Level Classification E-value
Superfamily 4-helical cytokines 3.71e-60
Family Long-chain cytokines 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
extracellular space 1.3 56.04
cytoplasmic vesicle part 1.417 13.65
endosome 1.351 13.65
filopodium 1.861 9.86
actin-based cell projection 1.622 6.95
cell leading edge 1.426 4.36
Molecular Function IC (bits) H-Score
cytokine receptor binding 1.974 73.79
cytokine binding 1.952 40.06
enzyme activator activity 1.431 16.66
cysteine-type peptidase activity 2.054 12.98
endopeptidase activity 1.571 9.1
growth factor receptor binding 2.188 4.33
hormone activity 1.767 4.3

Protein sequence

External link(s) P41159
Sequence length 167
Comment (sp|P41159|LEP_HUMAN) Obesity factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OB OC=Catarrhini; Hominidae; Homo.
Sequence
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Download sequence
Identical sequences A4D0Y8 P41159
ENSP00000312652 ENSP00000312652 ENSP00000312652 9606.ENSP00000312652 gi|4557715|ref|NP_000221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]