SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P41159 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P41159
Domain Number 1 Region: 24-167
Classification Level Classification E-value
Superfamily 4-helical cytokines 3.71e-60
Family Long-chain cytokines 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P41159
Sequence length 167
Comment (sp|P41159|LEP_HUMAN) Obesity factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OB OC=Catarrhini; Hominidae; Homo.
Sequence
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Download sequence
Identical sequences A4D0Y8 P41159
NP_000221.1.87134 NP_000221.1.92137 ENSP00000312652 9606.ENSP00000312652 ENSP00000312652 gi|4557715|ref|NP_000221.1| ENSP00000312652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]