SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P42330 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P42330
Domain Number 1 Region: 6-323
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 4.41e-172
Family Aldo-keto reductases (NADP) 0.0000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P42330
Sequence length 323
Comment (sp|P42330|AK1C3_HUMAN) Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=AKR1C3; OC=Catarrhini; Hominidae; Homo.
Sequence
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
Download sequence
Identical sequences P42330
ENSP00000369927 ENSP00000464178 4yvv_A 4yvv_B 4yvx_A 4yvx_B 4zfc_A 4zfc_B 9606.ENSP00000369927 ENSP00000369927 ENSP00000462706 ENSP00000369927 gi|24497583|ref|NP_003730.4| 400298 AKR1C3 NP_003730.4.87134 NP_003730.4.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]