SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P43155 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P43155
Domain Number 1 Region: 31-404
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.39e-134
Family Choline/Carnitine O-acyltransferase 0.00000000000094
Further Details:      
 
Domain Number 2 Region: 406-623
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.17e-82
Family Choline/Carnitine O-acyltransferase 0.00000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P43155
Sequence length 626
Comment (sp|P43155|CACP_HUMAN) Carnitine acetyltransferase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CRAT; OC=Catarrhini; Hominidae; Homo.
Sequence
MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSE
EEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSP
GVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSC
RVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSS
LQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVY
RSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIE
YTKKPELVRSPLVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKD
FPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVK
AMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMD
TSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNA
ARLAHYLEKALLDMRALLQSHPRAKL
Download sequence
Identical sequences P43155
ENSP00000315013 ENSP00000315013 9606.ENSP00000315013 ENSP00000315013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]