SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P43629 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P43629
Domain Number 1 Region: 121-219
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-27
Family I set domains 0.00000996
Further Details:      
 
Domain Number 2 Region: 27-119
Classification Level Classification E-value
Superfamily Immunoglobulin 2.83e-26
Family I set domains 0.0024
Further Details:      
 
Domain Number 3 Region: 220-317
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-23
Family I set domains 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P43629
Sequence length 444
Comment (sp|P43629|KI3L1_HUMAN) p70 natural killer cell receptor clones CL-2/CL-11 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KIR3DL1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFML
YKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGN
HRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANF
SIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS
PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLL
HLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT
PPTDTILYTELPNAKPRSKVVSCP
Download sequence
Identical sequences P43629 Q5UCE2
ENSP00000375608 ENSP00000479009 ENSP00000481802 ENSP00000484036 ENSP00000484488 ENSP00000484972 gi|134268644|ref|NP_037421.2| NP_037421.2.87134 NP_037421.2.92137 9606.ENSP00000375608 NYSGRC-IgSF-KI3L1_HUMAN ENSP00000375608 ENSP00000443350 ENSP00000474290 ENSP00000474733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]