SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P46092 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P46092
Domain Number 1 Region: 28-343
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.95e-54
Family Rhodopsin-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P46092
Sequence length 362
Comment (sp|P46092|CCR10_HUMAN) G-protein coupled receptor 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CCR10; OC=Catarrhini; Hominidae; Homo.
Sequence
MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNG
LVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLY
SASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFS
QDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGP
ERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL
ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSW
DN
Download sequence
Identical sequences H2QD32 P46092
ENSP00000332504 ENSPTRP00000015691 ENSPTRP00000015691 gi|156104886|ref|NP_057686.2| ATCG3D_68 9598.ENSPTRP00000015691 9606.ENSP00000332504 ENSP00000332504 ENSP00000332504 NP_057686.2.87134 NP_057686.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]