SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P47870 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P47870
Domain Number 1 Region: 38-241
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 6.15e-58
Family Nicotinic receptor ligand binding domain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 242-411,446-511
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 7.85e-54
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P47870
Sequence length 512
Comment (sp|P47870|GBRB2_HUMAN) GABA(A) receptor subunit beta-2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GABRB2; OC=Catarrhini; Hominidae; Homo.
Sequence
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKI
FYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA
VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD
LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
Download sequence
Identical sequences A0A2I3N1S0 A0A2I3TWN4 A0A2I4HY33 A0A2J8X6Y9 A0A2K5ESW6 A0A2K5HNA5 A0A2K5NFC3 A0A2K5XEM9 A0A2K6BER5 A0A2K6M1L0 A0A2K6Q4S3 A0A2K6S1V7 D1LYT2 F7EV84 G3RF14 G5ARH5 G7P6T5 P47870
ENSTSYP00000002987 ENSP00000274547 ENSP00000377531 ENSP00000274547 ENSP00000377531 NP_001161800.1.72884 NP_068711.1.87134 NP_068711.1.92137 XP_002816202.1.23681 XP_003268660.1.23891 XP_004836494.1.39548 XP_005558501.1.63531 XP_005558502.1.63531 XP_006165117.1.99106 XP_008013403.1.81039 XP_010343626.1.74449 XP_010343627.1.74449 XP_010343628.1.74449 XP_010387198.1.97406 XP_011738266.1.29376 XP_011738267.1.29376 XP_011803103.1.43180 XP_011822055.1.47321 XP_011906291.1.92194 XP_011906292.1.92194 XP_012316501.1.9421 XP_012596132.1.48125 XP_014200629.1.60992 XP_014200630.1.60992 XP_014996834.1.72884 XP_014996836.1.72884 XP_016809641.1.37143 XP_016809642.1.37143 XP_016809643.1.37143 XP_017744535.1.44346 XP_018884035.1.27298 XP_020139312.1.48125 HGL_H00000274547 ENSGGOP00000014168 ENSTSYP00000002987 ENSP00000274546 9598.ENSPTRP00000029889 9600.ENSPPYP00000017919 9606.ENSP00000274547 ENSGGOP00000014168 ENSPTRP00000029889 gi|12548785|ref|NP_068711.1| ENSPTRP00000029889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]