SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P47887 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P47887
Domain Number 1 Region: 1-320
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.02e-82
Family Rhodopsin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.428 73.38
cilium 1.675 18.22
ciliary part 1.819 15.9
receptor complex 1.469 9.53
cell body 1.534 9.34
endosome 1.351 7.79
membrane region 1.565 6.09
membrane raft 2.03 6.09
dendrite 1.582 5.8
organelle envelope 1.405 5.73

Protein sequence

External link(s) P47887
Sequence length 323
Comment (sp|P47887|OR1E2_HUMAN) Olfactory receptor 1E4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR1E2; OC=Catarrhini; Hominidae; Homo.
Sequence
MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY
LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY
DRYVAICFPMHYTAICFLLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCAD
NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS
KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYS
LRNRDMKGALERVICKRKNPFLL
Download sequence
Identical sequences A0A126GW81 P47887
ENSP00000248384 gi|11386153|ref|NP_003545.1| ENSP00000248384 ENSP00000248384 9606.ENSP00000248384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]