SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P47972 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P47972
Domain Number 1 Region: 242-419
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.59e-42
Family Pentraxin (pentaxin) 0.00069
Further Details:      
 
Weak hits

Sequence:  P47972
Domain Number - Region: 161-243
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.00497
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P47972
Sequence length 431
Comment (sp|P47972|NPTX2_HUMAN) Neuronal pentraxin II KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NPTX2; OC=Catarrhini; Hominidae; Homo.
Sequence
MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELR
AAVLQLRETVVQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP
GHVVEQLSRSLQTLKDRLESLEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAEL
EDEKSLLHNETSAHRQKTESTLNALLQRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKI
KKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQL
PLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVLILGQEQDTVG
GRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP
VETCEERLLDL
Download sequence
Identical sequences H2QUZ8 P47972
ENSP00000265634 gi|28195384|ref|NP_002514.1| ENSPTRP00000033253 9606.ENSP00000265634 ENSP00000265634 ENSP00000265634 ENSPTRP00000033253 NP_002514.1.87134 NP_002514.1.92137 XP_001136152.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]