SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P48060 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P48060
Domain Number 1 Region: 29-186
Classification Level Classification E-value
Superfamily PR-1-like 9.55e-51
Family PR-1-like 0.0000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P48060
Sequence length 266
Comment (sp|P48060|GLIP1_HUMAN) Protein RTVP-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GLIPR1; OC=Catarrhini; Hominidae; Homo.
Sequence
MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTW
DPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDE
IQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGN
YPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV
NSVILILSVIITILVQHKYPNLVLLD
Download sequence
Identical sequences H2Q6I0 P48060
gi|110825980|ref|NP_006842.2| 9598.ENSPTRP00000008897 9606.ENSP00000266659 ENSPTRP00000008897 NP_006842.2.87134 NP_006842.2.92137 XP_003832940.1.60992 XP_009424141.1.37143 ENSP00000266659 ENSP00000266659 ENSP00000266659 ENSPTRP00000008897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]