SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P48729 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P48729
Domain Number 1 Region: 12-298
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.8e-84
Family Protein kinases, catalytic subunit 0.000000000967
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P48729
Sequence length 337
Comment (sp|P48729|KC1A_HUMAN) CK1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CSNK1A1; OC=Catarrhini; Hominidae; Homo.
Sequence
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Download sequence
Identical sequences A0A1S2ZAL5 A0A250XYR2 A0A286XXZ0 A0A2I2ZQU5 A0A2J8X5Y1 A0A2K5CCQ0 A0A2K5SAB1 A0A2K6CPS4 A0A2K6TCH3 A0JPL2 F2Z4Z4 F7HFL0 G1LFH9 H2R587 H9YY07 M3X447 P48729 Q8BK63 W5P5Y5
ENSP00000367074 gi|68303572|ref|NP_001883.4| ENSRNOP00000062327 ENSMMUP00000002346 ENSCJAP00000039336 NP_001248164.1.72884 NP_001883.4.87134 NP_001883.4.92137 XP_001164031.1.37143 XP_002744403.1.60252 XP_003124136.1.46622 XP_003266672.1.23891 XP_003782098.1.62490 XP_003829087.1.60992 XP_003981453.2.62641 XP_004009007.1.66739 XP_004384966.1.4749 XP_004587606.1.84141 XP_004631343.1.9945 XP_004664819.1.11716 XP_004686930.1.23501 XP_004696773.1.18182 XP_005007043.1.53824 XP_005209613.1.76553 XP_005324234.1.77405 XP_005356231.1.66349 XP_005558282.1.63531 XP_005683211.1.57651 XP_005870522.1.60319 XP_006041087.1.26621 XP_006150939.1.99106 XP_006175976.1.101512 XP_006526451.1.92730 XP_006863924.1.41390 XP_006906444.1.64745 XP_006985211.1.50099 XP_007093434.1.5354 XP_007130728.1.24612 XP_007188742.1.59432 XP_007447559.1.90284 XP_007516450.1.11023 XP_008013134.1.81039 XP_008150414.1.99482 XP_008579134.1.73410 XP_008836128.1.79516 XP_010342831.1.74449 XP_010385168.1.97406 XP_010590092.1.64505 XP_010848838.1.44457 XP_010954396.1.22495 XP_010987788.1.51371 XP_011369440.1.92234 XP_011714342.1.29376 XP_011786923.1.43180 XP_011840771.1.47321 XP_011924125.1.92194 XP_011968755.1.54773 XP_012308922.1.9421 XP_012597028.1.48125 XP_012906595.1.14098 XP_014708089.1.49734 XP_014939063.1.86478 XP_015341534.1.40921 XP_016005839.1.101085 XP_017386817.1.71028 XP_017731304.1.44346 XP_018883043.1.27298 XP_019319932.1.44245 XP_019479961.1.44202 XP_019589894.1.88060 XP_019654050.1.58354 XP_019780265.1.83887 XP_019820776.1.53367 XP_020025588.1.5219 XP_020759081.1.74333 XP_021070609.1.100879 XP_021489360.1.76796 XP_021556407.1.83697 XP_536470.2.84170 ENSMUSP00000132083 ENSSTOP00000020247 ENSSSCP00000015364 ENSP00000367074 ENSAMEP00000005667 10090.ENSMUSP00000110901 9823.ENSSSCP00000015364 9913.ENSBTAP00000040522 ENSSSCP00000015364 ENSOARP00000005839 ENSSTOP00000020247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]