SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P49366 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P49366
Domain Number 1 Region: 13-363
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.55e-144
Family Deoxyhypusine synthase, DHS 0.00000000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P49366
Sequence length 369
Comment (sp|P49366|DHYS_HUMAN) Deoxyhypusine synthase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DHPS; OC=Catarrhini; Hominidae; Homo.
Sequence
MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFG
RAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLV
QHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFE
DWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGS
LGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGA
DYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKMD
AFMHEKNED
Download sequence
Identical sequences A0A024R7D0 P49366
9606.ENSP00000210060 ENSP00000210060 ENSP00000210060 cath|current|1rlzA00/9-369 gi|4503325|ref|NP_001921.1| 1rlz_A 1roz_A 1roz_B 1rqd_A 1rqd_B NP_001921.1.87134 NP_001921.1.92137 XP_011526072.1.92137 1rozA ENSP00000210060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]