SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P49720 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P49720
Domain Number 1 Region: 11-196
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.66e-65
Family Proteasome subunits 0.0000000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P49720
Sequence length 205
Comment (sp|P49720|PSB3_HUMAN) Proteasome theta chain KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PSMB3; OC=Catarrhini; Hominidae; Homo.
Sequence
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
Download sequence
Identical sequences K7B7X6 P49720
ENSP00000225426 002045270|e5ln331|210.1.1.2|3:1-205 gi|22538465|ref|NP_002786.2| 5gjq_c 5gjq_q 5gjr_c 5gjr_q 5l4g_3 5l4g_W 5le5_I 5le5_W 5lex_I 5lex_W 5ley_I 5ley_W 5lez_I 5lez_W 5lf0_I 5lf0_W 5lf1_I 5lf1_W 5lf3_I 5lf3_W 5lf4_I 5lf4_W 5lf6_I 5lf6_W 5lf7_I 5lf7_W 5ln3_3 5m32_I 5m32_W 6avo_U 6avo_Y NP_002786.2.87134 NP_002786.2.92137 XP_003809892.1.60992 XP_016787381.1.37143 ENSP00000225426 ENSP00000483688 ENSP00000483956 9606.ENSP00000225426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]