SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P51164 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P51164
Sequence length 291
Comment (sp|P51164|ATP4B_HUMAN) Proton pump beta chain KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ATP4B; OC=Catarrhini; Hominidae; Homo.
Sequence
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLY
VLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGY
SPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFI
IKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPH
YSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Download sequence
Identical sequences P51164
ENSP00000334216 NP_000696.1.87134 NP_000696.1.92137 ENSP00000334216 gi|4557339|ref|NP_000696.1| ENSP00000334216 9606.ENSP00000334216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]