SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P51812 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P51812
Domain Number 1 Region: 66-390
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-95
Family Protein kinases, catalytic subunit 0.0000000909
Further Details:      
 
Domain Number 2 Region: 402-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-81
Family Protein kinases, catalytic subunit 0.00000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P51812
Sequence length 740
Comment (sp|P51812|KS6A3_HUMAN) pp90RSK2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RPS6KA3; OC=Catarrhini; Hominidae; Homo.
Sequence
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
Download sequence
Identical sequences A0A0D9RPY4 F7GWP8 G3R0F8 H2PV35 K7DQL9 P51812
ENSCJAP00000009787 NP_004577.1.87134 NP_004577.1.92137 XP_002762752.1.60252 XP_002831491.1.23681 XP_003819605.1.60992 XP_007989448.1.81039 XP_012332996.1.9421 XP_016798365.1.37143 XP_018874904.1.27298 ENSP00000368865 ENSCJAP00000009787 gi|4759050|ref|NP_004577.1| ENSPPYP00000022577 HR6314 ENSPPYP00000022577 ENSP00000368884 9600.ENSPPYP00000022576 9606.ENSP00000368884 ENSP00000368884 ENSPANP00000007472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]