SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P51814 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P51814
Domain Number 1 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 434-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.23e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 64-125
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 657-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 713-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 769-818
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 322-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000157
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 286-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000223
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P51814
Sequence length 821
Comment (sp|P51814|ZNF41_HUMAN) Zinc finger protein 41 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF41; OC=Catarrhini; Hominidae; Homo.
Sequence
MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRSSADHAALN
SIVSLQASVSFEDVTVDFSKEEWQHLDPAQRRLYWDVTLENYSHLLSVGYQIPKSEAAFK
LEQGEGPWMLEGEAPHQSCSGEAIGKMQQQGIPGGIFFHCERFDQPIGEDSLCSILEELW
QDNDQLEQRQENQNNLLSHVKVLIKERGYEHKNIEKIIHVTTKLVPSIKRLHNCDTILKH
TLNSHNHNRNSATKNLGKIFGNGNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAP
THHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHP
SVYTGEKPYLCTQCGKVFTLKSNLITHQKIHTGQKPYKCSECGKAFFQRSDLFRHLRIHT
GEKPYECSECGKGFSQNSDLSIHQKTHTGEKHYECNECGKAFTRKSALRMHQRIHTGEKP
YVCADCGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFTKKSQLHVHQRIHTGEKPYICT
ECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFTDQSNLIKHQKTHTGEKPYKCNGCGK
AFIWKSRLKIHQKSHIGERHYECKDCGKAFIQKSTLSVHQRIHTGEKPYVCPECGKAFIQ
KSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDRSNL
ITHQKIHTREKPYECGDCGKTFTWKSRLNIHQKSHTGERHYECSKCGKAFIQKATLSMHQ
IIHTGKKPYACTECQKAFTDRSNLIKHQKMHSGEKRYKASD
Download sequence
Identical sequences P51814
NP_001311084.1.87134 NP_001311084.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]