SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P52272 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P52272
Domain Number 1 Region: 649-728
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.45e-24
Family Canonical RBD 0.0029
Further Details:      
 
Domain Number 2 Region: 174-283
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.49e-22
Family Canonical RBD 0.003
Further Details:      
 
Domain Number 3 Region: 68-175
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-20
Family Canonical RBD 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P52272
Sequence length 730
Comment (sp|P52272|HNRPM_HUMAN) Heterogeneous nuclear ribonucleoprotein M KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HNRNPM; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNR
FEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFK
MEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMITIP
PSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKD
GKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHG
LGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGMEGPFGGGMENM
GRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMG
AGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIG
SGVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAG
LERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPAL
GAGIERMGLAMGGGGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNL
PFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGR
EIDVRIDRNA
Download sequence
Identical sequences A0A0A0MWM4 A0A2I2YR12 A0A2I3SFL5 A0A2K5MG06 A0A2K5X867 A0A2K6A853 A0A2K6CSW8 F6ZI22 P52272
gi|14141152|ref|NP_005959.2| HR3655 ENSPTRP00000017736 ENSP00000325732 ENSPANP00000009850 ENSP00000325376 ENSPTRP00000017736 ENSP00000325376 NP_005959.2.87134 NP_005959.2.92137 XP_001159326.2.37143 XP_003810023.1.60992 XP_005587892.1.63531 XP_011740882.1.29376 XP_011821655.1.47321 XP_011932736.1.92194 XP_014978216.1.72884 XP_018870733.1.27298 9598.ENSPTRP00000017736 9606.ENSP00000325376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]