SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P52790 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P52790
Domain Number 1 Region: 677-917
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.41e-82
Family Hexokinase 0.0000000387
Further Details:      
 
Domain Number 2 Region: 467-675
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.22e-71
Family Hexokinase 0.000000648
Further Details:      
 
Domain Number 3 Region: 237-476
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.42e-70
Family Hexokinase 0.00000142
Further Details:      
 
Domain Number 4 Region: 27-230
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.09e-61
Family Hexokinase 0.00000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
focal adhesion 1.815 34.6
cell-substrate junction 1.548 31.97
actin-based cell projection 1.622 29.18
cell leading edge 1.426 23.31
chromosomal part 1.512 16.25
chromatin 1.876 16.25
nuclear chromosome part 1.842 16.25
cell body 1.534 16.15
transporter complex 1.698 14.42
actin cytoskeleton 1.374 13.99

Protein sequence

External link(s) P52790
Sequence length 923
Comment (sp|P52790|HXK3_HUMAN) Hexokinase type III KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HK3; OC=Catarrhini; Hominidae; Homo.
Sequence
MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQ
ALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEP
RSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRST
LISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVG
LVVDTGTNACYMEEARHVAVLDEDRGRVCVSVEWGSFSDDGALGPVLTTFDHTLDHESLN
PGAQRFEKMIGGLYLGELVRLVLAHLARCGVLFGGCTSPALLSQGSILLEHVAEMEDPST
GAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQ
VAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSLIPSVDGGGRGVAMVTAVAARLAAHR
RLLEETLAPFRLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTFVRATPDGSERGDFLA
LDLGGTNFRVLLVRVTTGVQITSEIYSIPETVAQGSGQQLFDHIVDCIVDFQQKQGLSGQ
SLPLGFTFSFPCRQLGLDQGILLNWTKGFKASDCEGQDVVSLLREAITRRQAVELNVVAI
VNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGD
DGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQ
RLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLC
GAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSE
DGSGKGAALVTAVACRLAQLTRV
Download sequence
Identical sequences A0A024R7R1 P52790
ENSP00000292432 ENSP00000292432 9606.ENSP00000292432 ENSP00000292432 gi|194097330|ref|NP_002106.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]