SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P53004 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P53004
Domain Number 1 Region: 130-246
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 8.5e-50
Family Biliverdin reductase 0.00000154
Further Details:      
 
Domain Number 2 Region: 5-138
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.81e-25
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P53004
Sequence length 296
Comment (sp|P53004|BIEA_HUMAN) Biliverdin-IX alpha-reductase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BLVRA; OC=Catarrhini; Hominidae; Homo.
Sequence
MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLE
DALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKV
LHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLF
GELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLEN
VPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Download sequence
Identical sequences A0A140VJF4 P53004
NP_000703.2.87134 NP_000703.2.92137 NP_001240752.1.87134 NP_001240752.1.92137 XP_011513776.1.92137 XP_016868009.1.92137 ENSP00000265523 ENSP00000385757 9606.ENSP00000265523 ENSP00000265523 ENSP00000385757 ENSP00000265523 gi|33589854|ref|NP_000703.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]