SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P54315 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P54315
Domain Number 1 Region: 18-354
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.33e-104
Family Pancreatic lipase, N-terminal domain 0.0000000000339
Further Details:      
 
Domain Number 2 Region: 354-467
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 4.32e-38
Family Colipase-binding domain 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P54315
Sequence length 467
Comment (sp|P54315|LIPR1_HUMAN) Inactive pancreatic lipase-related protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PNLIPRP1; OC=Catarrhini; Hominidae; Homo.
Sequence
MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYT
NENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC
ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEA
GSKTPGLSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMG
HLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGV
SITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC
Download sequence
Identical sequences P54315
ENSP00000351695 ENSP00000433933 ENSP00000351695 ENSP00000458464 9606.ENSP00000351695 gi|5453920|ref|NP_006220.1| NP_001290064.1.87134 NP_001290064.1.92137 NP_006220.1.87134 NP_006220.1.92137 XP_011538170.1.92137 ENSP00000351695 ENSP00000433933 ENSP00000458759 ENSP00000461234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]