SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P55008 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P55008
Domain Number 1 Region: 31-111
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000242
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P55008
Sequence length 147
Comment (sp|P55008|AIF1_HUMAN) Protein G1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=AIF1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLN
GNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKM
ILMYEEKAREKEKPTGPPAKKAISELP
Download sequence
Identical sequences A0A2K6CS95 G1R2M9 G3R8K9 P55008 Q4V347
ENSGGOP00000011720 ENSNLEP00000007451 ENSP00000365227 ENSP00000372966 ENSP00000391720 ENSP00000397842 ENSP00000398013 ENSP00000416061 ENSGGOP00000011720 GO.33780 gi|14574568|ref|NP_001614.3| ENSP00000365227 ENSP00000372966 ENSP00000391720 ENSP00000397842 ENSP00000398013 ENSP00000416061 ENSNLEP00000007451 9606.ENSP00000365227 NP_001614.3.87134 NP_001614.3.92137 XP_003272151.1.23891 XP_003831631.1.60992 XP_004043704.1.27298 XP_011767198.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]