SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P55265 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P55265
Domain Number 1 Region: 126-198
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.94e-23
Family Z-DNA binding domain 0.0000341
Further Details:      
 
Domain Number 2 Region: 494-570
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 9.1e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0015
Further Details:      
 
Domain Number 3 Region: 295-365
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.15e-17
Family Z-DNA binding domain 0.000031
Further Details:      
 
Domain Number 4 Region: 604-684
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.96e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0035
Further Details:      
 
Domain Number 5 Region: 719-796
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.62e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P55265
Sequence length 1226
Comment (sp|P55265|DSRAD_HUMAN) K88DSRBP KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ADAR; OC=Catarrhini; Hominidae; Homo.
Sequence
MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQ
TPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQ
RGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLA
KKGKLQKEAGTPPLWKIAVSTQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSED
LLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPEDSNSTSALEDPLEFLDMAEIK
EKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKR
ERMQIKRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLE
NRQEARPEPARLKPPVHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMP
SFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVV
INGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKAKDSGKSEESSHYSTEKESEKTAESQ
TPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPKFQYCVAVGAQTFPSV
SAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRKIGELV
RYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQG
KQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTF
HDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLS
LKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLY
ISTAPCGDGALFDKSCSDRAMESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVP
TWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAI
CCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILD
GTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFK
KGLKDMGYGNWISKPQEEKNFYLCPV
Download sequence
Identical sequences P55265
9606.ENSP00000357459 ENSP00000357459 ENSP00000357459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]