SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P56706 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P56706
Sequence length 349
Comment (sp|P56706|WNT7B_HUMAN) Protein Wnt-7b KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=WNT7B; OC=Catarrhini; Hominidae; Homo.
Sequence
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVT
AACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM
NLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEV
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG
ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Download sequence
Identical sequences A0A096NKR7 A0A0D9QZ47 A0A2I3HZL1 A0A2I3TH72 A0A2K5P8S6 A0A2K5VJD2 A0A2K5ZBV8 A0A2K6BRE8 H2P4S1 P56706
ENSP00000341032 ENSP00000341032 ENSPANP00000013574 9600.ENSPPYP00000013324 9606.ENSP00000341032 ENSPPYP00000013324 NP_478679.1.87134 NP_478679.1.92137 XP_001110372.2.72884 XP_003281317.1.23891 XP_005567064.1.63531 XP_007974275.1.81039 XP_011753226.1.29376 XP_011839428.1.47321 XP_011917931.1.92194 XP_016794881.1.37143 gi|17505193|ref|NP_478679.1| ENSPPYP00000013324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]