SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P58417 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P58417
Sequence length 271
Comment (sp|P58417|NXPH1_HUMAN) Neurexophilin-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NXPH1; OC=Catarrhini; Hominidae; Homo.
Sequence
MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLS
QTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFG
WGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQ
QTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICI
YISFYSTDYKLVQKVCPDYNYHSDTPYFPSG
Download sequence
Identical sequences A0A2I2Z2Q4 A0A2I3TGN7 P58417 Q3LID8
NP_689958.1.87134 NP_689958.1.92137 XP_008976933.1.60992 XP_009450929.1.37143 XP_016812582.1.37143 XP_018885885.1.27298 ENSP00000384551 9598.ENSPTRP00000032347 9606.ENSP00000384551 gi|23097338|ref|NP_689958.1| ENSP00000384551 HR131 ENSP00000384551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]