SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P58417 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P58417
Sequence length 271
Comment (sp|P58417|NXPH1_HUMAN) Neurexophilin-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NXPH1; OC=Catarrhini; Hominidae; Homo.
Sequence
MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLS
QTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFG
WGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQ
QTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICI
YISFYSTDYKLVQKVCPDYNYHSDTPYFPSG
Download sequence
Identical sequences P58417 Q3LID8
9598.ENSPTRP00000032347 9606.ENSP00000384551 HR131 ENSP00000384551 gi|23097338|ref|NP_689958.1| ENSP00000384551 ENSP00000384551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]