SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P58546 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P58546
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-35
Family Ankyrin repeat 0.000000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
intracellular ribonucleoprotein complex 1.368 39.27
presynapse 1.758 33.61
nuclear transcription factor complex 2.016 15.02
dendrite 1.582 11.63
cytoplasmic ribonucleoprotein granule 1.929 11.58
nucleoplasm part 1.369 10.32
polymeric cytoskeletal fiber 1.688 10.17
actin cytoskeleton 1.374 10.17
actin filament 2.235 10.17
transferase complex 1.369 9.56

Protein sequence

External link(s) P58546
Sequence length 118
Comment (sp|P58546|MTPN_HUMAN) Protein V-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MTPN; OC=Catarrhini; Hominidae; Homo.
Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Download sequence
Identical sequences A0A096MWD2 A0A0D9R975 A0A1S3ALX4 A0A1U7UEZ0 D2GYP3 F6R615 F6YKL4 F7H568 F7HNN3 G1RTC2 G3QJ87 G3WSN4 G7P0W7 H2PNM0 H2R2H5 K9IG76 K9IVW4 L8I5R4 M3XY57 P58546 Q3T0F7 Q69YG1 Q863Z4 S9WNE3 U6CWC9
13616.ENSMODP00000017474 9544.ENSMMUP00000022512 9598.ENSPTRP00000043964 9600.ENSPPYP00000020234 9606.ENSP00000349140 9615.ENSCAFP00000004991 9796.ENSECAP00000021733 9913.ENSBTAP00000010269 ENSMPUP00000004008 ENSTBEP00000000807 ENSTBEP00000000807 ENSCAFP00000039244 ENSECAP00000021733 ENSNLEP00000016496 ENSP00000376800 ENSSHAP00000018439 ENSAMEP00000019105 ENSGGOP00000002472 ENSPANP00000004188 ENSP00000376800 ENSPPYP00000020234 ENSPPYP00000020234 ENSGGOP00000002472 ENSCJAP00000023402 ENSCJAP00000023414 ENSMODP00000017474 ENSPTRP00000043964 ENSMMUP00000022512 ENSMMUP00000034736 ENSPTRP00000043964 ENSNLEP00000016496 ENSECAP00000021733 ENSMMUP00000022512 ENSDNOP00000034517 ENSCAFP00000039244 ENSBTAP00000010269 ENSMPUP00000004008 gi|21956645|ref|NP_665807.1| ENSCJAP00000023402 ENSP00000376800 ENSAMEP00000019105 ENSBTAP00000010269 ENSMODP00000017474 ENSSHAP00000018439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]