SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P58546 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P58546
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-35
Family Ankyrin repeat 0.000000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P58546
Sequence length 118
Comment (sp|P58546|MTPN_HUMAN) Protein V-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MTPN; OC=Catarrhini; Hominidae; Homo.
Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Download sequence
Identical sequences A0A096MWD2 A0A0D9R975 A0A1S3ALX4 A0A1U7UEZ0 A0A2I2ZQ07 A0A2K5BYM2 A0A2K5JDK7 A0A2K5LSL5 A0A2K5QSY9 A0A2K5Y0N5 A0A2K6EAZ3 A0A2K6EPM2 A0A2K6LWK9 A0A2K6RC31 A0A2K6SHB0 D2GYP3 F6R615 F6YKL4 F7H568 F7HNN3 G1RTC2 G3WSN4 G7P0W7 H2PNM0 H2R2H5 K9IG76 K9IVW4 L8I5R4 M3XY57 P58546 Q3T0F7 Q69YG1 Q863Z4 S9WNE3 U6CWC9
ENSP00000376800 ENSNLEP00000016496 ENSCJAP00000023402 ENSCJAP00000023414 ENSP00000376800 ENSDNOP00000034517 ENSGGOP00000002472 ENSNLEP00000016496 ENSPPYP00000020234 ENSCAFP00000039244 ENSSHAP00000018439 ENSPTRP00000043964 ENSMPUP00000004008 ENSECAP00000021733 ENSSHAP00000018439 ENSGGOP00000002472 ENSBTAP00000010269 ENSTBEP00000000807 ENSCAFP00000039244 ENSMMUP00000022512 ENSMMUP00000034736 ENSPPYP00000020234 gi|21956645|ref|NP_665807.1| 13616.ENSMODP00000017474 9544.ENSMMUP00000022512 9598.ENSPTRP00000043964 9600.ENSPPYP00000020234 9606.ENSP00000349140 9615.ENSCAFP00000004991 9796.ENSECAP00000021733 9913.ENSBTAP00000010269 ENSMPUP00000004008 ENSBTAP00000010269 ENSAMEP00000019105 ENSAMEP00000019105 ENSCJAP00000023402 ENSPTRP00000043964 ENSMODP00000017474 ENSMMUP00000022512 ENSMODP00000017474 ENSTBEP00000000807 ENSPANP00000004188 ENSP00000376800 NP_001247673.1.72884 NP_001270816.1.63531 NP_665807.1.87134 NP_665807.1.92137 NP_976238.2.59421 NP_976238.2.76553 XP_001367623.1.35504 XP_001499940.1.31192 XP_002914249.1.58354 XP_003261428.1.23891 XP_003771684.1.9362 XP_003791642.1.62490 XP_003813479.1.60992 XP_003921017.1.74449 XP_004046325.1.27298 XP_004272213.1.21590 XP_004406411.1.74151 XP_004430781.1.5094 XP_004470517.1.11602 XP_004608294.1.94378 XP_004677129.1.23501 XP_004741755.1.14098 XP_005679564.1.57651 XP_005903704.1.15283 XP_005959015.1.78601 XP_006041233.1.26621 XP_006186155.1.101512 XP_006213163.1.17985 XP_006734390.1.47382 XP_007117497.1.24612 XP_007177164.1.59432 XP_007466651.1.90284 XP_007537063.1.11023 XP_007981221.1.81039 XP_008063852.1.4292 XP_008524495.1.77740 XP_008705829.1.72690 XP_009001253.1.60252 XP_009241534.1.23681 XP_010372934.1.97406 XP_010829925.1.44457 XP_010945798.1.22495 XP_010981464.1.51371 XP_011722072.1.29376 XP_011796651.1.43180 XP_011855502.1.47321 XP_011855504.1.47321 XP_011923623.1.92194 XP_012321145.1.9421 XP_012498231.1.63892 XP_014694832.1.49734 XP_017387990.1.71028 XP_017534826.1.32401 XP_017743232.1.44346 XP_019606195.1.88060 XP_019806277.1.83887 XP_019814707.1.53367 XP_020729691.1.74333 XP_020853820.1.61212 XP_021548555.1.83697 XP_519405.2.37143 ENSECAP00000021733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]