SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P59046 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P59046
Domain Number 1 Region: 610-1051
Classification Level Classification E-value
Superfamily RNI-like 9.31e-94
Family 28-residue LRR 0.00000163
Further Details:      
 
Domain Number 2 Region: 12-92
Classification Level Classification E-value
Superfamily DEATH domain 7.65e-23
Family Pyrin domain, PYD 0.0026
Further Details:      
 
Domain Number 3 Region: 207-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000717
Family Extended AAA-ATPase domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
receptor complex 1.469 21.28
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74

Protein sequence

External link(s) P59046
Sequence length 1061
Comment (sp|P59046|NAL12_HUMAN) Regulated by nitric oxide KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NLRP12; OC=Catarrhini; Hominidae; Homo.
Sequence
MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEKAGPLEMAQLL
ITHFGPEEAWRLALSTFERINRKDLWERGQREDLVRDTPPGGPSSLGNQSTCLLEVSLVT
PRKDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLVKEHSNPMQVQQQLLDTG
RGHARTVGHQASPIKIETLFEPDEERPEPPRTVVMQGAAGIGKSMLAHKVMLDWADGKLF
QGRFDYLFYINCREMNQSATECSMQDLIFSCWPEPSAPLQELIRVPERLLFIIDGFDELK
PSFHDPQGPWCLCWEEKRPTELLLNSLIRKKLLPELSLLITTRPTALEKLHRLLEHPRHV
EILGFSEAERKEYFYKYFHNAEQAGQVFNYVRDNEPLFTMCFVPLVCWVVCTCLQQQLEG
GGLLRQTSRTTTAVYMLYLLSLMQPKPGAPRLQPPPNQRGLCSLAADGLWNQKILFEEQD
LRKHGLDGEDVSAFLNMNIFQKDINCERYYSFIHLSFQEFFAAMYYILDEGEGGAGPDQD
VTRLLTEYAFSERSFLALTSRFLFGLLNEETRSHLEKSLCWKVSPHIKMDLLQWIQSKAQ
SDGSTLQQGSLEFFSCLYEIQEEEFIQQALSHFQVIVVSNIASKMEHMVSSFCLKRCRSA
QVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSL
YRNALGSRGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIANKNLTRMDLSGN
GVGFPGMMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNPHLVELDLTGNALE
DLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLG
VLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWL
LAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCK
RLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC
Download sequence
Identical sequences P59046
gi|21955154|ref|NP_653288.1| hso003013097.1 hso003013097.2 ENSP00000319377 ENSP00000319377 9606.ENSP00000319377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]