SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P59796 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P59796
Domain Number 1 Region: 39-216
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-50
Family Glutathione peroxidase-like 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P59796
Sequence length 221
Comment (sp|P59796|GPX6_HUMAN) Glutathione peroxidase 6 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GPX6; OC=Catarrhini; Hominidae; Homo.
Sequence
MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYGALTLNGEEYIQFKQFA
GKHVLFVNVAAYUGLAAQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLK
YVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMHWFHQAPVSTVKSDILEYLKQFNTH
Download sequence
Identical sequences P59796
gi|33186887|ref|NP_874360.1| NP_874360.1.87134 NP_874360.1.92137 ENSP00000354581 ENSP00000354581 ENSP00000354581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]