SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P61244 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P61244
Domain Number 1 Region: 23-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.72e-21
Family HLH, helix-loop-helix DNA-binding domain 0.00000571
Further Details:      
 
Weak hits

Sequence:  P61244
Domain Number - Region: 85-140
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0876
Family Phase 1 flagellin 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P61244
Sequence length 160
Comment (sp|P61244|MAX_HUMAN) Myc-associated factor X {ECO:0000312|HGNC:HGNC:6913} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MAX OC=Catarrhini; Hominidae; Homo.
Sequence
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
Download sequence
Identical sequences A0A287AZK8 A0A2I3MV47 A0A2K5LSM0 A0A2K5RBB6 A0A2K5TST3 A0A2K6A7T1 A0A2K6BTG7 A0A2K6GBE6 A0A2K6QVT2 A0A2K6UI83 E2QZS2 F6U9F3 F6XM92 G1L9T1 G1RW72 G3TKT2 H2NLJ2 H2Q8G8 I3MZG3 K9IGK6 M3Y654 P61244 P61245
ENSCJAP00000036622 ENSSTOP00000017509 ENSP00000351490 ENSNLEP00000017500 gi|21704261|ref|NP_002373.3| 9544.ENSMMUP00000005809 9598.ENSPTRP00000010940 9600.ENSPPYP00000006719 9606.ENSP00000351490 9615.ENSCAFP00000023887 9823.ENSSSCP00000002476 ENSCAFP00000023887 NP_001009866.1.62641 NP_002373.3.87134 NP_002373.3.92137 XP_002824897.1.23681 XP_002914193.1.58354 XP_003267864.1.23891 XP_003314427.1.37143 XP_003408763.1.64505 XP_003824094.1.60992 XP_003924485.1.74449 XP_004262182.1.21590 XP_004409433.1.74151 XP_004649319.1.11716 XP_004681833.1.23501 XP_004738999.1.14098 XP_005322853.1.77405 XP_005666373.1.46622 XP_006142473.1.99106 XP_006207024.1.17985 XP_006738678.1.47382 XP_006873120.1.41390 XP_007116421.1.24612 XP_007940481.1.48129 XP_007985179.1.81039 XP_008581160.1.73410 XP_010333460.1.74449 XP_010382014.1.97406 XP_010960571.1.22495 XP_010974941.1.51371 XP_011725955.1.29376 XP_011833705.1.47321 XP_011909199.1.92194 XP_012511698.1.63892 XP_012633189.1.48125 XP_014999326.1.72884 XP_016079351.1.3490 XP_017389501.1.71028 XP_017832646.1.60252 XP_019307086.1.44245 XP_019307087.1.44245 XP_019778160.1.83887 XP_021556994.1.83697 XP_852901.1.84170 ENSAMEP00000003654 ENSMMUP00000005813 ENSMMUP00000005809 ENSCJAP00000036602 ENSPPYP00000006719 ENSPTRP00000010940 ENSSTOP00000017509 ENSCAFP00000023887 ENSPTRP00000010940 ENSP00000351490 ENSP00000351175 ENSMPUP00000006805 ENSLAFP00000015453 ENSPPYP00000006719 ENSNLEP00000017499 ENSAMEP00000003654 ENSMPUP00000006805 ENSLAFP00000027626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]