SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P61916 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P61916
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily E set domains 3.27e-43
Family ML domain 0.000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P61916
Sequence length 151
Comment (sp|P61916|NPC2_HUMAN) Niemann-Pick disease type C2 protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NPC2 OC=Catarrhini; Hominidae; Homo.
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVT
FTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Download sequence
Identical sequences A0A024R6C0 A0A0D9RJC1 A0A2I3LDJ9 A0A2K5J007 A0A2K5M766 A0A2K6AFL1 A0A2K6DD46 I0FNJ1 K7B6K2 P61916 P61917 P61918
ENSNLEP00000019724 ENSP00000451112 NP_001009075.1.37143 NP_001253689.1.72884 NP_006423.1.87134 NP_006423.1.92137 XP_003260798.1.23891 XP_004055485.1.27298 XP_005561827.1.63531 XP_007985463.1.81039 XP_009426323.1.37143 XP_011763886.1.29376 XP_011804958.1.43180 XP_011836916.1.47321 XP_011926238.1.92194 XP_014999599.1.72884 ENSP00000451112 ENSPTRP00000011092 ENSGGOP00000028288 ENSMMUP00000008638 ENSPTRP00000011092 ENSMMUP00000008638 gi|5453678|ref|NP_006423.1| 9544.ENSMMUP00000008638 9598.ENSPTRP00000011092 9606.ENSP00000238633 ENSNLEP00000019724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]