SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P62807 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P62807
Domain Number 1 Region: 28-124
Classification Level Classification E-value
Superfamily Histone-fold 6.11e-91
Family Nucleosome core histones 0.00000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P62807
Sequence length 126
Comment (sp|P62807|H2B1C_HUMAN) Histone H2B.l KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HIST1H2BI; OC=Catarrhini; Hominidae; Homo.
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences A0A091DTR6 A0A096NFZ7 A0A0D9SCL5 A0A1S3AGG4 A0A1S3GFF9 A0A1U7Q7A3 A0A1U7TD85 A0A250XUY6 A0A286XMB9 A0A2J8S4Y0 A0A2K5C3J0 A0A2K5HBB8 A0A2K5KSI4 A0A2K5PBI4 A0A2K5XCR2 A0A2K6AUH4 A0A2K6EK83 A0A2K6KJI2 A0A2K6NTJ7 A0A2K6SBF8 B2R4S9 D2HWJ0 F7ASE9 F7H6T6 F7HAP1 G1Q760 G1S9R7 G1TP83 G3HDT7 G3RXM3 G3UJB0 G3V8B3 G5BV27 G7P2P1 H0XF87 H2RDL9 H9GWB1 I3LAJ9 I3N8F0 L5JTA7 L5LWE9 L8IUP8 L8YGC5 M3X6T1 M3Z4I3 P62807 P62808 Q5R893 Q6ZWY9 S7PD05 S9WX78 W5QFQ8
ENSFCAP00000003630 ENSFCAP00000005547 ENSFCAP00000010271 ENSFCAP00000015525 ENSFCAP00000016316 ENSTSYP00000006279 ENSTSYP00000013607 ENSOPRP00000000205 ENSOPRP00000000236 ENSOPRP00000001147 ENSOPRP00000007695 ENSOPRP00000007713 ENSOPRP00000007721 ENSOPRP00000011464 ENSOPRP00000011470 ENSOPRP00000015175 ENSOPRP00000015176 ENSEEUP00000000451 ENSEEUP00000005574 ENSEEUP00000008493 ENSEEUP00000008623 ENSPPYP00000018237 ENSPPYP00000018241 ENSPPYP00000018246 ENSETEP00000002688 ENSETEP00000002932 ENSETEP00000005701 NP_001032546.1.59421 NP_001032546.1.76553 NP_001100822.1.100692 NP_001100822.1.4139 NP_001126171.1.23681 NP_001171124.1.92730 NP_001277309.1.92730 NP_001277459.1.92730 NP_003509.1.87134 NP_003509.1.92137 NP_003513.1.87134 NP_003513.1.92137 NP_003514.2.87134 NP_003514.2.92137 NP_003516.1.87134 NP_003516.1.92137 NP_003517.2.87134 NP_003517.2.92137 NP_075911.2.92730 NP_835501.1.92730 NP_835503.1.92730 XP_001071972.1.4139 XP_001086167.1.72884 XP_001087459.1.72884 XP_001497452.1.31192 XP_001927752.1.46622 XP_002686101.1.76553 XP_002697553.1.76553 XP_002697561.1.76553 XP_002702931.1.59421 XP_002714237.1.1745 XP_002714255.1.1745 XP_002721665.1.1745 XP_002721671.1.1745 XP_002725314.1.4139 XP_002746216.1.60252 XP_002764205.1.60252 XP_002803690.1.72884 XP_002816569.1.23681 XP_002927132.1.58354 XP_002928578.1.58354 XP_002928585.1.58354 XP_003263306.1.23891 XP_003263307.1.23891 XP_003263313.1.23891 XP_003263328.1.23891 XP_003311104.1.37143 XP_003416445.1.64505 XP_003416448.1.64505 XP_003416457.1.64505 XP_003416458.1.64505 XP_003416462.1.64505 XP_003416466.1.64505 XP_003421157.1.64505 XP_003463261.1.53824 XP_003463262.1.53824 XP_003468844.1.53824 XP_003468847.1.53824 XP_003468856.1.53824 XP_003502216.1.69978 XP_003502218.1.69978 XP_003505646.1.69978 XP_003583950.1.59421 XP_003587771.1.76553 XP_003640205.1.84170 XP_003640206.1.84170 XP_003640209.1.84170 XP_003788841.1.62490 XP_003788844.1.62490 XP_003788846.1.62490 XP_003801902.1.62490 XP_003801904.1.62490 XP_003804474.1.60992 XP_003804482.1.60992 XP_003804487.1.60992 XP_003804591.1.60992 XP_003927313.1.74449 XP_003985731.1.62641 XP_003985739.1.62641 XP_003985743.1.62641 XP_003985755.1.62641 XP_003985756.1.62641 XP_003985765.1.62641 XP_003985769.1.62641 XP_004019078.1.66739 XP_004019079.1.66739 XP_004019091.1.66739 XP_004019114.1.66739 XP_004019122.1.66739 XP_004019123.1.66739 XP_004019124.1.66739 XP_004043435.1.27298 XP_004043449.1.27298 XP_004043451.1.27298 XP_004043463.1.27298 XP_004088812.1.23891 XP_004384077.1.4749 XP_004384079.1.4749 XP_004384083.1.4749 XP_004384086.1.4749 XP_004413704.1.74151 XP_004413709.1.74151 XP_004413716.1.74151 XP_004432087.1.5094 XP_004432089.1.5094 XP_004432100.1.5094 XP_004463561.1.11602 XP_004463562.1.11602 XP_004463563.1.11602 XP_004463570.1.11602 XP_004463571.1.11602 XP_004463577.1.11602 XP_004588891.1.84141 XP_004596561.1.84141 XP_004598448.1.84141 XP_004621944.1.94378 XP_004621992.1.94378 XP_004621996.1.94378 XP_004628476.1.9945 XP_004628478.1.9945 XP_004640168.1.9945 XP_004640171.1.9945 XP_004640173.1.9945 XP_004670881.1.11716 XP_004694906.1.23501 XP_004694914.1.23501 XP_004694917.1.23501 XP_004694920.1.23501 XP_004695482.1.23501 XP_004712546.1.18182 XP_004712547.1.18182 XP_004778810.1.14098 XP_004847606.1.39548 XP_004847607.1.39548 XP_004847608.1.39548 XP_005000682.1.53824 XP_005066533.1.91757 XP_005066534.1.91757 XP_005086734.1.91757 XP_005086737.1.91757 XP_005086745.1.91757 XP_005337106.1.77405 XP_005337109.1.77405 XP_005337115.1.77405 XP_005337118.1.77405 XP_005337132.1.77405 XP_005354996.1.66349 XP_005399009.1.28644 XP_005403348.1.28644 XP_005403354.1.28644 XP_005403362.1.28644 XP_005403363.1.28644 XP_005553844.1.63531 XP_005553867.1.63531 XP_005553870.1.63531 XP_005553881.1.63531 XP_005603683.1.31192 XP_005640166.1.84170 XP_005640167.1.84170 XP_005696798.1.57651 XP_005696799.1.57651 XP_005696802.1.57651 XP_005696805.1.57651 XP_005696810.1.57651 XP_005701751.1.57651 XP_005701752.1.57651 XP_005863136.1.60319 XP_005863137.1.60319 XP_005863146.1.60319 XP_005869064.1.60319 XP_005892263.1.15283 XP_005892270.1.15283 XP_005910220.1.15283 XP_005910221.1.15283 XP_005960026.1.78601 XP_005960028.1.78601 XP_005982804.1.78601 XP_005982806.1.78601 XP_005982807.1.78601 XP_005982810.1.78601 XP_005982812.1.78601 XP_005982826.1.78601 XP_005982827.1.78601 XP_006040929.1.26621 XP_006048045.1.26621 XP_006048072.1.26621 XP_006048078.1.26621 XP_006048082.1.26621 XP_006058484.1.26621 XP_006105760.1.53796 XP_006105761.1.53796 XP_006105762.1.53796 XP_006105765.1.53796 XP_006105897.1.53796 XP_006105901.1.53796 XP_006106487.1.53796 XP_006107725.1.53796 XP_006107727.1.53796 XP_006108975.1.53796 XP_006162717.1.99106 XP_006162726.1.99106 XP_006182229.1.101512 XP_006182232.1.101512 XP_006182237.1.101512 XP_006215321.1.17985 XP_006735967.1.47382 XP_006735969.1.47382 XP_006735976.1.47382 XP_006736839.1.47382 XP_006760034.1.95426 XP_006760035.1.95426 XP_006760039.1.95426 XP_006760043.1.95426 XP_006764350.1.95426 XP_006764352.1.95426 XP_006764357.1.95426 XP_006872835.1.41390 XP_006872837.1.41390 XP_006872862.1.41390 XP_006872869.1.41390 XP_006872870.1.41390 XP_006888681.1.29581 XP_006888682.1.29581 XP_006888688.1.29581 XP_006888690.1.29581 XP_006888693.1.29581 XP_006923509.1.64745 XP_006923530.1.64745 XP_006923535.1.64745 XP_006931454.1.62641 XP_006988912.1.50099 XP_006988925.1.50099 XP_006993215.1.50099 XP_006993219.1.50099 XP_006993223.1.50099 XP_006993224.1.50099 XP_006993228.1.50099 XP_006999012.1.50099 XP_007074505.1.5354 XP_007074507.1.5354 XP_007074510.1.5354 XP_007074512.1.5354 XP_007074513.1.5354 XP_007074533.1.5354 XP_007096069.1.5354 XP_007531636.1.11023 XP_007531639.1.11023 XP_007534624.1.11023 XP_007534628.1.11023 XP_007534633.1.11023 XP_007534636.1.11023 XP_007620820.1.28591 XP_007620822.1.28591 XP_007634647.1.28591 XP_007634671.1.28591 XP_007640987.1.69978 XP_007948022.1.48129 XP_007948028.1.48129 XP_007948039.1.48129 XP_007948044.1.48129 XP_007948045.1.48129 XP_007948049.1.48129 XP_007955078.1.48129 XP_007955086.1.48129 XP_007971655.1.81039 XP_007971660.1.81039 XP_007971662.1.81039 XP_007971675.1.81039 XP_008054454.1.4292 XP_008055786.1.4292 XP_008055795.1.4292 XP_008055799.1.4292 XP_008145270.1.99482 XP_008145276.1.99482 XP_008246696.1.1745 XP_008260673.1.1745 XP_008260693.1.1745 XP_008260695.1.1745 XP_008539390.1.77740 XP_008539396.1.77740 XP_008539401.1.77740 XP_008566067.1.73410 XP_008566069.1.73410 XP_008566071.1.73410 XP_008585832.1.73410 XP_008585833.1.73410 XP_008691179.1.72690 XP_008691180.1.72690 XP_008691188.1.72690 XP_008691197.1.72690 XP_008691207.1.72690 XP_008691239.1.72690 XP_008691245.1.72690 XP_008693972.1.72690 XP_008769904.1.100692 XP_008769991.1.100692 XP_008769994.1.100692 XP_008772195.1.4139 XP_008772224.1.4139 XP_008772227.1.4139 XP_008830083.1.79516 XP_008830087.1.79516 XP_008830092.1.79516 XP_008992068.1.60252 XP_008992078.1.60252 XP_008992080.1.60252 XP_009239769.1.23681 XP_009239778.1.23681 XP_009448908.1.37143 XP_010336292.1.74449 XP_010336294.1.74449 XP_010362896.1.97406 XP_010362917.1.97406 XP_010363033.1.97406 XP_010363046.1.97406 XP_010363106.1.97406 XP_010594469.1.64505 XP_010621299.1.5607 XP_010621309.1.5607 XP_010816749.1.76553 XP_010816750.1.76553 XP_010816751.1.76553 XP_010816752.1.76553 XP_010816754.1.76553 XP_010816755.1.76553 XP_010816756.1.76553 XP_010816757.1.76553 XP_010816759.1.76553 XP_010816816.1.76553 XP_010823688.1.59421 XP_010823689.1.59421 XP_010823690.1.59421 XP_010823691.1.59421 XP_010823693.1.59421 XP_010823694.1.59421 XP_010823695.1.59421 XP_010823697.1.59421 XP_010823715.1.59421 XP_010825135.2.59421 XP_010830601.1.44457 XP_010832333.1.44457 XP_010832336.1.44457 XP_010837043.1.44457 XP_010837044.1.44457 XP_010841727.1.44457 XP_010841733.1.44457 XP_010841738.1.44457 XP_010851435.1.44457 XP_010972454.1.22495 XP_010972460.1.22495 XP_010972497.1.22495 XP_010972501.1.22495 XP_010972509.1.22495 XP_010978467.1.51371 XP_010978469.1.51371 XP_011364635.1.92234 XP_011364647.1.92234 XP_011741081.1.29376 XP_011741094.1.29376 XP_011741096.1.29376 XP_011741102.1.29376 XP_011818237.1.43180 XP_011818246.1.43180 XP_011818252.1.43180 XP_011818255.1.43180 XP_011818262.1.43180 XP_011821817.1.47321 XP_011821824.1.47321 XP_011821838.1.47321 XP_011886938.1.92194 XP_011886951.1.92194 XP_011886953.1.92194 XP_011886961.1.92194 XP_012014264.2.54773 XP_012014268.1.54773 XP_012014273.1.54773 XP_012014278.1.54773 XP_012020680.1.54773 XP_012020688.1.54773 XP_012020689.1.54773 XP_012020704.1.54773 XP_012314004.1.9421 XP_012314005.1.9421 XP_012314007.1.9421 XP_012314008.1.9421 XP_012364481.1.23891 XP_012372133.1.9945 XP_012382622.1.11602 XP_012422570.1.74151 XP_012494078.1.63892 XP_012494079.1.63892 XP_012494092.1.63892 XP_012596786.1.48125 XP_012596787.1.48125 XP_012596788.1.48125 XP_012886715.1.60039 XP_012886716.1.60039 XP_012886717.1.60039 XP_012886718.1.60039 XP_012890664.1.60039 XP_012890665.1.60039 XP_012890666.1.60039 XP_012890667.1.60039 XP_012890668.1.60039 XP_012904568.1.14098 XP_012928647.1.39548 XP_012981137.1.91757 XP_013006890.1.53824 XP_013006891.1.53824 XP_013006892.1.53824 XP_013204538.1.66349 XP_013204540.1.66349 XP_013204541.1.66349 XP_013216605.1.77405 XP_013219120.1.77405 XP_013829532.1.57651 XP_013966035.1.84170 XP_013966111.1.84170 XP_013967643.1.84170 XP_014200731.1.60992 XP_014303297.1.53796 XP_014303410.1.53796 XP_014303411.1.53796 XP_014332614.1.15283 XP_014392555.1.60319 XP_014397406.1.60319 XP_014397407.1.60319 XP_014448835.1.99106 XP_014589729.1.31192 XP_014589774.1.31192 XP_014651787.1.5094 XP_014684670.1.49734 XP_014684671.1.49734 XP_014684673.1.49734 XP_014707026.1.49734 XP_014707051.1.49734 XP_014707054.1.49734 XP_014929235.1.86478 XP_014941937.1.86478 XP_014941939.1.86478 XP_014941940.1.86478 XP_014945809.1.54773 XP_014958045.1.66739 XP_014991218.1.72884 XP_015315427.1.76553 XP_015324467.1.59421 XP_015349611.1.40921 XP_015349613.1.40921 XP_015349615.1.40921 XP_015349616.1.40921 XP_015349617.1.40921 XP_015349643.1.40921 XP_015349644.1.40921 XP_015349645.1.40921 XP_015396024.1.5354 XP_015396028.1.5354 XP_015396031.1.5354 XP_015396033.1.5354 XP_015396035.1.5354 XP_015396071.1.5354 XP_015396159.1.5354 XP_015453813.1.64745 XP_015989073.1.101085 XP_015989085.1.101085 XP_015989167.1.101085 XP_015989180.1.101085 XP_015989201.1.101085 XP_015989217.1.101085 XP_015989239.1.101085 XP_016071732.1.3490 XP_016071765.1.3490 XP_016071767.1.3490 XP_016071768.1.3490 XP_016071770.1.3490 XP_016071771.1.3490 XP_016071772.1.3490 XP_016071773.1.3490 XP_016071786.1.3490 XP_016075780.1.3490 XP_016075781.1.3490 XP_016075785.1.3490 XP_016075786.1.3490 XP_016810517.1.37143 XP_016810520.1.37143 XP_016830964.1.69978 XP_017360680.1.71028 XP_017360682.1.71028 XP_017375487.1.71028 XP_017704621.1.44346 XP_017704645.1.44346 XP_017704646.1.44346 XP_017704647.1.44346 XP_017704648.1.44346 XP_017894035.1.57651 XP_019280732.1.44245 XP_019280733.1.44245 XP_019280734.1.44245 XP_019280739.1.44245 XP_019280740.1.44245 XP_019280742.1.44245 XP_019280743.1.44245 XP_019280744.1.44245 XP_019280763.1.44245 XP_019280860.1.44245 XP_019486828.1.44202 XP_019569750.1.88060 XP_019569751.1.88060 XP_019569753.1.88060 XP_019569754.1.88060 XP_019569756.1.88060 XP_019569757.1.88060 XP_019569759.1.88060 XP_019569760.1.88060 XP_019812172.1.53367 XP_019840860.1.53367 XP_019840861.1.53367 XP_019840862.1.53367 XP_019840864.1.53367 XP_019841106.1.53367 XP_019841109.1.53367 XP_019841110.1.53367 XP_019841112.1.53367 XP_019841863.1.53367 XP_019841864.1.53367 XP_020006756.1.5219 XP_020009000.1.5219 XP_020009012.1.5219 XP_020009020.1.5219 XP_020009027.1.5219 XP_020009046.1.5219 XP_020009053.1.5219 XP_020727368.1.74333 XP_020742246.1.74333 XP_020742255.1.74333 XP_020742257.1.74333 XP_020742303.1.74333 XP_020758579.1.74333 XP_020758605.1.74333 XP_020955495.1.46622 XP_020955500.1.46622 XP_021071069.1.100879 XP_021071387.1.100879 XP_021071626.1.100879 XP_021500542.1.76796 XP_021552523.1.83697 XP_021552524.1.83697 XP_527258.1.37143 XP_545389.1.84170 XP_581429.3.59421 XP_599845.2.59421 XP_854227.1.84170 XP_854244.1.84170 XP_859568.1.84170 ENSMLUP00000019543 ENSMLUP00000020055 ENSMLUP00000020898 ENSMLUP00000020904 ENSMLUP00000021218 ENSMLUP00000021893 ENSMLUP00000022650 ENSCJAP00000020320 ENSCJAP00000020323 ENSCJAP00000041355 ENSCHOP00000002505 ENSCHOP00000009142 ENSCHOP00000012418 ENSOCUP00000016055 ENSOCUP00000016549 ENSOCUP00000017391 ENSOCUP00000017892 ENSOCUP00000018815 ENSOCUP00000023586 ENSOCUP00000024508 ENSOCUP00000024966 ENSSSCP00000001203 ENSSSCP00000021067 ENSGGOP00000019730 ENSGGOP00000020559 ENSGGOP00000024088 ENSGGOP00000028247 ENSOARP00000021556 ENSOGAP00000007156 ENSOGAP00000014663 ENSOGAP00000018260 ENSMLUP00000018788 ENSMLUP00000019543 ENSMLUP00000020055 ENSMLUP00000020898 ENSMLUP00000020904 ENSMLUP00000021218 ENSMLUP00000021893 ENSMLUP00000022650 ENSDNOP00000006586 ENSDNOP00000016950 ENSDNOP00000016963 ENSMMUP00000003763 ENSRNOP00000028779 ENSRNOP00000065931 ENSRNOP00000066625 ENSRNOP00000067422 ENSCHOP00000002505 ENSCHOP00000009142 ENSCHOP00000012418 ENSVPAP00000003979 ENSVPAP00000006023 ENSVPAP00000007657 ENSFCAP00000017817 ENSFCAP00000019571 ENSFCAP00000019795 ENSFCAP00000022333 ENSFCAP00000022670 ENSFCAP00000022801 ENSFCAP00000022954 ENSFCAP00000023039 ENSCPOP00000015130 ENSCPOP00000017701 ENSCPOP00000018179 ENSCPOP00000018720 ENSCPOP00000019438 ENSCPOP00000020167 ENSCPOP00000020218 ENSCPOP00000020454 ENSCPOP00000020879 ENSECAP00000002882 ENSECAP00000003847 ENSECAP00000004062 ENSECAP00000005145 ENSOPRP00000000205 ENSOPRP00000000236 ENSOPRP00000001147 ENSOPRP00000007695 ENSOPRP00000007713 ENSOPRP00000007721 ENSOPRP00000011464 ENSOPRP00000011470 ENSOPRP00000015175 ENSOPRP00000015176 ENSTBEP00000003121 ENSCAFP00000016675 ENSCAFP00000036635 ENSCAFP00000040042 ENSCAFP00000040141 ENSCAFP00000042942 ENSRNOP00000024276 ENSRNOP00000028779 ENSRNOP00000049203 ENSMPUP00000018495 ENSMICP00000005491 ENSMICP00000005494 ENSMICP00000015735 ENSVPAP00000003979 ENSVPAP00000006023 ENSVPAP00000007657 ENSMUSP00000018246 ENSMUSP00000061247 ENSMUSP00000078239 5kgf_D 5kgf_H 6c0w_D 6c0w_H ENSAMEP00000019577 HGL_H00000380177-1 HGL_H00000380177-3 ENSMPUP00000018495 ENSNLEP00000003799 ENSNLEP00000022253 ENSNLEP00000022256 ENSNLEP00000022258 ENSNLEP00000022266 ENSAMEP00000019577 10090.ENSMUSP00000018246 10116.ENSRNOP00000024276 10116.ENSRNOP00000028779 10116.ENSRNOP00000049203 10141.ENSCPOP00000015130 10141.ENSCPOP00000017701 10141.ENSCPOP00000018179 10141.ENSCPOP00000018720 10141.ENSCPOP00000019438 10141.ENSCPOP00000020167 10141.ENSCPOP00000020218 10141.ENSCPOP00000020454 10141.ENSCPOP00000020879 9361.ENSDNOP00000006586 9361.ENSDNOP00000016950 9361.ENSDNOP00000016963 9544.ENSMMUP00000003763 9598.ENSPTRP00000030395 9598.ENSPTRP00000030405 9598.ENSPTRP00000057493 9598.ENSPTRP00000059078 9598.ENSPTRP00000059319 9600.ENSPPYP00000018237 9600.ENSPPYP00000018241 9600.ENSPPYP00000018246 9600.ENSPPYP00000018254 9606.ENSP00000321744 9606.ENSP00000342886 9606.ENSP00000348924 9606.ENSP00000353074 9606.ENSP00000366962 9615.ENSCAFP00000016675 9685.ENSFCAP00000003630 9685.ENSFCAP00000005547 9685.ENSFCAP00000010271 9685.ENSFCAP00000015525 9685.ENSFCAP00000016316 9796.ENSECAP00000002882 9796.ENSECAP00000003847 9796.ENSECAP00000004062 9796.ENSECAP00000005145 9823.ENSSSCP00000001192 9823.ENSSSCP00000001195 9823.ENSSSCP00000001198 9823.ENSSSCP00000001203 9823.ENSSSCP00000001213 9823.ENSSSCP00000001239 9913.ENSBTAP00000024155 9913.ENSBTAP00000039503 9913.ENSBTAP00000047687 9913.ENSBTAP00000048201 9913.ENSBTAP00000049889 9913.ENSBTAP00000051301 9913.ENSBTAP00000051376 9913.ENSBTAP00000051428 9913.ENSBTAP00000052160 9913.ENSBTAP00000052168 9913.ENSBTAP00000052479 9986.ENSOCUP00000016055 9986.ENSOCUP00000016549 9986.ENSOCUP00000017391 9986.ENSOCUP00000017892 9986.ENSOCUP00000018815 9986.ENSOCUP00000023586 9986.ENSOCUP00000024508 9986.ENSOCUP00000024966 ENSGGOP00000019730 ENSGGOP00000020559 ENSGGOP00000024088 ENSGGOP00000028247 ENSPCAP00000011071 ENSPCAP00000014899 ENSPCAP00000014909 ENSPCAP00000016019 ENSPCAP00000016076 ENSPCAP00000016104 ENSPCAP00000016120 ENSETEP00000002688 ENSETEP00000002932 ENSETEP00000005701 ENSCAFP00000016675 ENSCAFP00000036635 ENSCAFP00000040042 ENSCAFP00000040141 ENSCAFP00000042942 ENSOCUP00000016055 ENSOCUP00000016549 ENSOCUP00000017391 ENSOCUP00000017892 ENSOCUP00000018815 ENSOCUP00000023586 ENSOCUP00000024508 ENSOCUP00000024966 ENSCJAP00000020273 ENSCJAP00000020320 ENSCJAP00000020323 ENSCJAP00000041053 ENSCJAP00000041355 ENSOGAP00000007156 ENSOGAP00000014663 ENSOGAP00000018260 ENSNLEP00000003799 ENSNLEP00000022253 ENSNLEP00000022256 ENSNLEP00000022258 ENSNLEP00000022266 ENSDORP00000004914 ENSDORP00000004917 ENSDORP00000004918 ENSDORP00000004921 ENSDORP00000004929 ENSDORP00000008208 ENSDORP00000008212 ENSDORP00000008236 ENSDORP00000004914 ENSDORP00000004917 ENSDORP00000004918 ENSDORP00000004921 ENSDORP00000004929 ENSDORP00000008208 ENSDORP00000008212 ENSDORP00000008236 ENSMUSP00000018246 ENSMUSP00000061247 ENSMUSP00000078239 ENSMUSP00000089296 ENSSSCP00000001203 ENSSSCP00000021067 ENSEEUP00000000451 ENSEEUP00000005574 ENSEEUP00000008493 ENSEEUP00000008623 ENSPANP00000000922 ENSPANP00000005110 ENSPANP00000011855 ENSPANP00000013820 ENSBTAP00000024155 ENSBTAP00000039503 ENSBTAP00000047687 ENSBTAP00000048201 ENSBTAP00000049889 ENSBTAP00000051376 ENSBTAP00000051428 ENSBTAP00000052160 ENSBTAP00000052168 ENSBTAP00000055514 ENSSTOP00000017297 ENSSTOP00000017538 ENSSTOP00000018551 ENSSTOP00000020646 ENSSTOP00000023950 ENSSTOP00000023963 ENSPTRP00000030395 ENSPTRP00000030405 ENSPTRP00000057493 ENSPTRP00000059078 ENSPTRP00000059319 ENSTSYP00000006279 ENSTSYP00000013607 ENSBTAP00000024155 ENSBTAP00000039503 ENSBTAP00000047687 ENSBTAP00000048201 ENSBTAP00000049889 ENSBTAP00000051376 ENSBTAP00000051428 ENSBTAP00000052160 ENSBTAP00000052168 ENSBTAP00000055514 ENSTBEP00000003121 ENSLAFP00000005967 ENSLAFP00000022509 ENSLAFP00000022709 ENSLAFP00000027918 ENSLAFP00000028008 ENSSARP00000001381 ENSSARP00000001876 ENSSARP00000001884 ENSSARP00000003188 ENSSARP00000004300 ENSSARP00000009370 ENSSARP00000009383 ENSSARP00000012111 ENSSARP00000012112 ENSMMUP00000003763 ENSSARP00000001381 ENSSARP00000001876 ENSSARP00000001884 ENSSARP00000003188 ENSSARP00000004300 ENSSARP00000009370 ENSSARP00000009383 ENSSARP00000012111 ENSSARP00000012112 gi|21166389|ref|NP_003517.2| gi|21396484|ref|NP_003514.2| gi|4504257|ref|NP_003509.1| gi|4504265|ref|NP_003513.1| gi|4504271|ref|NP_003516.1| ENSMUSP00000018246 ENSMUSP00000061247 ENSMUSP00000078239 ENSPVAP00000014492 ENSPVAP00000015563 ENSPVAP00000016602 ENSPVAP00000016608 ENSPVAP00000016612 ENSPVAP00000016614 ENSPTRP00000030395 ENSPTRP00000030405 ENSPTRP00000057493 ENSPTRP00000059078 ENSPTRP00000059319 ENSPPYP00000018237 ENSPPYP00000018241 ENSPPYP00000018246 ENSECAP00000002882 ENSECAP00000003847 ENSECAP00000004062 ENSECAP00000005145 ENSLAFP00000005967 ENSLAFP00000022509 ENSLAFP00000022709 ENSLAFP00000027918 ENSLAFP00000028008 ENSSTOP00000017297 ENSSTOP00000017538 ENSSTOP00000018551 ENSSTOP00000020646 ENSSTOP00000023950 ENSSTOP00000023963 ENSP00000321744 ENSP00000348924 ENSP00000366962 ENSP00000380180 ENSP00000445633 ENSP00000483237 ENSDNOP00000027163 ENSPVAP00000014492 ENSPVAP00000015563 ENSPVAP00000016602 ENSPVAP00000016608 ENSPVAP00000016612 ENSPVAP00000016614 ENSCPOP00000015130 ENSCPOP00000017701 ENSCPOP00000018179 ENSCPOP00000018720 ENSCPOP00000019438 ENSCPOP00000020167 ENSCPOP00000020218 ENSCPOP00000020454 ENSCPOP00000020879 ENSP00000244601 ENSP00000321744 ENSP00000348924 ENSP00000353074 ENSP00000366962 ENSP00000380180 ENSP00000244601 ENSP00000321744 ENSP00000348924 ENSP00000353074 ENSP00000366962 ENSMICP00000005491 ENSMICP00000005494 ENSMICP00000015735 ENSPCAP00000011071 ENSPCAP00000014899 ENSPCAP00000014909 ENSPCAP00000016019 ENSPCAP00000016076 ENSPCAP00000016104 ENSPCAP00000016120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]